seo site checkup logo
PricingFree ToolsArticles
Report generated 8 minutes ago
https://alfaisal.law
Your general SEO Checkup Score
Archived
73/100
SEO Score
17 Failed
4 Warnings
51 Passed
Issues to fix
Last found on Invalid Date
HIGH
This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
HIGH
This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
HIGH
The size of this webpage's HTML is 46.97 Kb, and is greater than the average size of 33 Kb! This can lead to slower loading times, lost visitors, and decreased revenue. Good steps to reduce HTML size include: using HTML compression, CSS layouts, external style sheets, and moving javascript to external files.
HIGH
This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
MEDIUM
This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
MEDIUM
This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
MEDIUM
This website is not using cache headers for images. Setting cache headers can help speed up the serving of a webpage for returning users. Learn more about how to add expires headers to your images.
MEDIUM
The Document Object Model (DOM) of this webpage has 3,585 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
MEDIUM
We've found JavaScript errors on this webpage!
MEDIUM
Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
MEDIUM
This webpage is using target="_blank" links without rel="noopener" or rel="noreferrer" attribute, which can expose it to performance and security issues!
LOW
This webpage has some errors caught by the Chrome DevTools Console!
LOW
This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
LOW
We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
LOW
This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
LOW
This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
LOW
This webpage is using inline CSS styles!
Common SEO issues
Score: 72
Failed: 5
Warnings: 2
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Faisal Saleem Advocates & Legal Consultants
Length: 43 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 116 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: We offer the refreshing culture of a client-focused legal services to the communities we serve in Dubai and the UAE.
Length: 116 characters
Google Search Results Preview Test
Desktop version
https://alfaisal.lawFaisal Saleem Advocates & Legal ConsultantsWe offer the refreshing culture of a client-focused legal services to the communities we serve in Dubai and the UAE.
Mobile version
https://alfaisal.lawFaisal Saleem Advocates & Legal ConsultantsWe offer the refreshing culture of a client-focused legal services to the communities we serve in Dubai and the UAE.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Faisal Saleem Advocates & Legal Consultants
og:description
We offer the refreshing culture of a client-focused legal services to the communities we serve in Dubai and the UAE.
og:url
https://alfaisal.law/
og:site_name
Al Faisal Law
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
29legal20business17cookies15faisal15salem
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
legal
business
cookies
faisal
salem
Keywords Cloud Test
acceptaccordanceaccusedaddressadeptadvertisementadviseadvocatesalfaisalanalyzeassetsavailablebasicbestbuildbusinesscertainclientclientscommercialcompetentcomprehensiveconsentconsultantsconsultationcontactcontentcookiescrimecriminaldefencedefensediscreetlydisplaydivorcedubaiefficientestateexperienceexpertiseexplicitfaisalfamilyfeaturesfunctionalfunctionalitieshavehelpinfoinformationinvestigationlawyerslegallegallylitigationmannernecessaryneedneedsoptionsorientedperformperformanceplanningpreferencespremiumpreserveprivacyprofessionalprotectionprovidereadrejectsalemserveservicesetupsitesituationspecificstandsuccessfulsupportswiftlyteamtomorrowtraffictrustunderstandunderstandingupdatesusedusingvaluevastvisitorswealthwebsitewiderwishes
Competitor Domains Test
Understand your competitors' SEO profile

Side-by-side SEO comparisons of up to 5 competitors. See how your SEO can improve against the competition.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Redefining the Futurepractice of Law
H2 tags
Blending legal expertise with the legal technology of tomorrow
Robots.txt Test94% of top 100 sites passed
  • Congratulations! Your site uses a "robots.txt" file.
https://alfaisal.law/robots.txt
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
https://alfaisal.law/sitemap_index.xml
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Need to track more websites?
Get between 3 and 15 monitored websites and supercharge your SEO.
Speed optimizations
Score: 63
Failed: 8
Warnings: 1
Passed: 14
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 3,585 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 412.24 Kb to 46.97 Kb (89% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.81 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
css
42.3 %
2.83 Mb
image
41.5 %
2.78 Mb
javascript
9.0 %
613.45 Kb
font
4.1 %
283.71 Kb
other
2.3 %
155.66 Kb
html
0.8 %
57.72 Kb
TOTAL
100%
6.69 Mb
Requests by content type
Content type
Percent
Requests
javascript
32.1 %
27
css
26.2 %
22
image
25.0 %
21
font
9.5 %
8
other
6.0 %
5
html
1.2 %
1
TOTAL
100%
84
Content size by domain
Domain
Percent
Size
alfaisal.law
95.7 %
6.40 Mb
cdn.buttonizer.io
1.4 %
93.81 Kb
googletagmanager.com
1.1 %
77.61 Kb
c0.wp.com
0.9 %
64.19 Kb
fonts.gstatic.com
0.8 %
56.18 Kb
stats.wp.com
0.0 %
3.10 Kb
fonts.googleapis.com
0.0 %
1.28 Kb
api.buttonizer.io
0.0 %
490 B
google-analytics.com
0.0 %
303 B
pixel.wp.com
0.0 %
93 B
TOTAL
100%
6.69 Mb
Requests by domain
Domain
Percent
Requests
alfaisal.law
77.4 %
65
c0.wp.com
8.3 %
7
fonts.gstatic.com
4.8 %
4
cdn.buttonizer.io
2.4 %
2
fonts.googleapis.com
1.2 %
1
googletagmanager.com
1.2 %
1
stats.wp.com
1.2 %
1
pixel.wp.com
1.2 %
1
google-analytics.com
1.2 %
1
api.buttonizer.io
1.2 %
1
TOTAL
100%
84
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
See results list
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 1.42 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.
Largest Contentful Paint element within the viewport:
<img class="btMainLogo" data-hw="2.5409252669039" src="https://alfaisal.law/wp-content/uploads/2022/10/lo..." alt="Al Faisal Law">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.001. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.
DOM element which contributes the most to CLS score:
Text: We value your privacy We use cookies to enhance your browsing experience, serve...
Html: <div class="cky-consent-container cky-box-bottom-left">
Score: 0.0007
Track up to 5 competitors 24/7
Analyze SEO metrics & get important information about your competition.
Server and security
Score: 86
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "alfaisal.law" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.alfaisal.law
Subject Alternative Names (SANs)
*.alfaisal.law, alfaisal.law
Not valid before
Not valid after
Signature algorithm
sha256WithRsaEncryption
Issuer
Encryption Everywhere DV TLS CA - G1
Intermediate certificate
Common name
Encryption Everywhere DV TLS CA - G1
Organization
DigiCert Inc
Location
US
Not valid before
Not valid after
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root CA
Root certificate
Common name
DigiCert Global Root CA
Organization
DigiCert Inc
Location
US
Not valid before
Not valid after
Signature algorithm
sha1WithRsaEncryption
Issuer
DigiCert Global Root CA
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Monitor your website keywords
Get useful insights and detailed metrics for your most important keywords.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1, user-scalable=no" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Your branded PDF Report is almost ready
Wow your clients with white labeled SEO Reports.
Advanced SEO
Score: 90
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://alfaisal.law is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://alfaisal.law/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
Check your website's SEO for free right now!
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2009-2022 • All rights reserved