seo site checkup logo
PricingFree ToolsArticles
Report generated in 13 hours
https://www.tripzygo.in
Your general SEO Checkup Score
Archived
67/100
SEO Score
15 Failed
7 Warnings
50 Passed
Issues to fix
Last found on Invalid Date
HIGH
This webpage is using JavaScript files that are not minified!
HIGH
This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
HIGH
The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
HIGH
This webpage doesn't take the advantages of HTML Microdata or JSON-LD specifications in order to use structured data! View Google's guide for getting started with structured data.
HIGH
This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
HIGH
This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
MEDIUM
This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
MEDIUM
The Document Object Model (DOM) of this webpage has 4,374 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
MEDIUM
Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
MEDIUM
This webpage is using target="_blank" links without rel="noopener" or rel="noreferrer" attribute, which can expose it to performance and security issues!
MEDIUM
This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
LOW
This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
LOW
This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
LOW
This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
LOW
This webpage is using inline CSS styles!
Common SEO issues
Score: 55
Failed: 6
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 63 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: TripzyGo - Book Best Tour Packages For Memorable Vacation Plans
Length: 63 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 28 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Generated by create next app
Length: 28 characters
Google Search Results Preview Test
Desktop version
https://www.tripzygo.inTripzyGo - Book Best Tour Packages For Memorable Vacation PlansGenerated by create next app
Mobile version
https://www.tripzygo.inTripzyGo - Book Best Tour Packages For Memorable Vacation PlansGenerated by create next app
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
44trip32tripzygo30packages25travel23experience
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
trip
tripzygo
packages
travel
experience
Keywords Cloud Test
advisorsagrawalamazingassistanceavailablebalibeachesbeautifulbestblogsbookbookedcateredcherishedcomfortcontactconveniencecustomisedcustomizeddaggardealsdefinitelydelightfuldestinationsdomesticallydubaieuropeexecutedexperienceexperiencesfriendsgavegreatgrouphavehelphillinsanelyinternationallyjourneykeralalifelohmorhlondonluckyluxurymalaysiamaldivesmanagedmanishmemorablememoriesmitalineedneedsnicenidhipackagesperfectperfectlypermissionplanplannedplanningreadreallyrequiredrequirementsshimlashubhisingaporesoonspainspecificstarsstationsumitsurelythailandthankthanksthankyoutimetipstourtouringtourstraveltravellertriptripstripzytripzygovacationvaniviewwentwideworldyashika
Competitor Domains Test
Understand your competitors' SEO profile

Side-by-side SEO comparisons of up to 5 competitors. See how your SEO can improve against the competition.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Travel Around forExperiencesMomentsAdventuresFeelingsExperiences
India's Best Travel Experiences
Best Travel Packages
Last Minute Deals
Why Choose Us
We Partner With The Best
Where To Go | What To See
Client's Testimonials
Robots.txt Test94% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
https://www.tripzygo.in/sitemap.xml
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Pinterest Twitter 
Need to track more websites?
Get between 3 and 15 monitored websites and supercharge your SEO.
Speed optimizations
Score: 67
Failed: 6
Warnings: 2
Passed: 15
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 11.91 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 4,374 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 83.33 Kb to 11.91 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.91 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
70.1 %
3.12 Mb
javascript
18.7 %
850.08 Kb
other
5.0 %
227.71 Kb
css
4.8 %
218.58 Kb
font
1.2 %
53.26 Kb
html
0.2 %
8.36 Kb
TOTAL
100%
4.44 Mb
Requests by content type
Content type
Percent
Requests
image
45.8 %
66
javascript
34.0 %
49
css
10.4 %
15
other
6.3 %
9
font
2.8 %
4
html
0.7 %
1
TOTAL
100%
144
Content size by domain
Domain
Percent
Size
tripzygo.in
86.6 %
3.85 Mb
cdnjs.cloudflare.com
5.9 %
269.66 Kb
googletagmanager.com
3.0 %
134.26 Kb
connect.facebook.net
2.5 %
111.59 Kb
maxcdn.bootstrapcdn.com
0.8 %
36.46 Kb
clarity.ms
0.5 %
24.66 Kb
fonts.gstatic.com
0.5 %
23.71 Kb
backend.tripzygo.in
0.1 %
2.33 Kb
fonts.googleapis.com
0.0 %
1.63 Kb
googleads.g.doubleclick.net
0.0 %
1.48 Kb
Other
0.0 %
1.65 Kb
TOTAL
100%
4.44 Mb
Requests by domain
Domain
Percent
Requests
tripzygo.in
79.2 %
114
cdnjs.cloudflare.com
5.6 %
8
fonts.gstatic.com
2.1 %
3
maxcdn.bootstrapcdn.com
1.4 %
2
fonts.googleapis.com
1.4 %
2
googletagmanager.com
1.4 %
2
clarity.ms
1.4 %
2
connect.facebook.net
1.4 %
2
facebook.com
1.4 %
2
m.clarity.ms
1.4 %
2
Other
3.5 %
5
TOTAL
100%
144
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 2.88 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.
Largest Contentful Paint element within the viewport:
<div class="video-banner">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.031. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.
DOM element which contributes the most to CLS score:
Text: Delightful Destinations India's Best Travel Experiences Have the most fun filled...
Html: <div class="col-lg-5">
Score: 0.0294
Track up to 5 competitors 24/7
Analyze SEO metrics & get important information about your competition.
Server and security
Score: 84
Failed: 1
Warnings: 1
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate will expire in less than a month!

The hostname "www.tripzygo.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.tripzygo.in
Subject Alternative Names (SANs)
www.tripzygo.in
Not valid before
Not valid after
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Not valid after
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Not valid after
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=63072000
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Monitor your website keywords
Get useful insights and detailed metrics for your most important keywords.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Your branded PDF Report is almost ready
Wow your clients with white labeled SEO Reports.
Advanced SEO
Score: 60
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
Check your website's SEO for free right now!
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2009-2022 • All rights reserved